PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G21920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 491aa    MW: 51905.6 Da    PI: 5.0369
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G21920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-1656103148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WTt Ed  lv+ v+q G g+W+++ r+ g+ R++k+c++rw ++l
  OMERI03G21920.1  56 KGPWTTAEDAVLVQHVRQNGEGNWNAVQRMTGLLRCGKSCRLRWTNHL 103
                      79******************************99***********996 PP

2Myb_DNA-binding513.4e-16109152146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++++E++l++++++qlG++ W++ a++++ gRt++++k++w++
  OMERI03G21920.1 109 KGSFSPDEELLIAQLHAQLGNK-WARMASHLP-GRTDNEIKNYWNT 152
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.18351103IPR017930Myb domain
SuperFamilySSF466899.73E-2855150IPR009057Homeodomain-like
SMARTSM007171.1E-1255105IPR001005SANT/Myb domain
PfamPF002493.3E-1356103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2057110IPR009057Homeodomain-like
CDDcd001678.63E-1058103No hitNo description
PROSITE profilePS5129422.55104158IPR017930Myb domain
SMARTSM007178.0E-15108156IPR001005SANT/Myb domain
PfamPF002493.9E-15109152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-24111157IPR009057Homeodomain-like
CDDcd001676.99E-11111152No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MEEMIKPAPA PASSEEEKEV MATAATGERR HEEATAGREE QEEEEGEEEA PVVLKKGPWT  60
TAEDAVLVQH VRQNGEGNWN AVQRMTGLLR CGKSCRLRWT NHLRPNLKKG SFSPDEELLI  120
AQLHAQLGNK WARMASHLPG RTDNEIKNYW NTRTKRRQRA GLPVYPPDVQ LHLAFAKRCR  180
YDDFSSPLSS PQQSAGSNVL SMDAADAAGA ASSGYTSARP PPLDLAGQLT MGSRPVQLLA  240
ATPFSAPSSP WGKPFARNAQ FFQFPHSSPV SPTTPTGPVH VHPVTPELSL GYGPHAGDRA  300
RLPPVSPSPG ARAELPSSQL RPAMAPTTAT AAAAATTGVL VGGALQDHPN AASLEAMLQE  360
LHDAIKIEPP APPENRGTEE GGGGDLRGVS GDGKPEVELK DDIETLFDLI IPATFPAAAA  420
PEPAAAMASS AAPNHSGSVS QHSSEDQDHS NADVVLDLPI LTGGGGGSSE QDDWSLDGAA  480
CQWNNISGGI C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-285415725127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1479620.0AC147962.1 Oryza sativa chromosome 3 BAC OSJNBa0083K01 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629365.10.0PREDICTED: myb-related protein P
TrEMBLA0A0E0D3510.0A0A0E0D351_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g38210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP74203750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.23e-65myb domain protein 101